Protein Info for PS417_28120 in Pseudomonas simiae WCS417

Annotation: N5-carboxyaminoimidazole ribonucleotide mutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01162: phosphoribosylaminoimidazole carboxylase, catalytic subunit
  • amino acids 5 to 158 (154 residues), 220.3 bits, E=4.3e-70
• PF00731: AIRC
  • amino acids 5 to 152 (148 residues), 211.5 bits, E=2.1e-67

Best Hits

Swiss-Prot: 91% identical to PURE_PSEAE: N5-carboxyaminoimidazole ribonucleotide mutase (purE) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01588, 5-(carboxyamino)imidazole ribonucleotide mutase [EC: 5.4.99.18] (inferred from 99% identity to pfl:PFL_6126)

MetaCyc: 66% identical to N5-carboxyaminoimidazole ribonucleotide mutase (Escherichia coli K-12 substr. MG1655)
5-(carboxyamino)imidazole ribonucleotide mutase. [EC: 5.4.99.18]

Predicted SEED Role

"Phosphoribosylaminoimidazole carboxylase catalytic subunit (EC 4.1.1.21)" in subsystem De Novo Purine Biosynthesis (EC 4.1.1.21)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (44/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (24/26 steps found)
• inosine-5'-phosphate biosynthesis I (6/6 steps found)
• inosine-5'-phosphate biosynthesis II (5/5 steps found)
• inosine-5'-phosphate biosynthesis III (5/6 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.21

Use Curated BLAST to search for 4.1.1.21 or 5.4.99.18

Sequence Analysis Tools

See A0A1N7U8X9 at UniProt or InterPro

Protein Sequence (163 amino acids)

>PS417_28120 N5-carboxyaminoimidazole ribonucleotide mutase (Pseudomonas simiae WCS417)
MSALVGVIMGSKSDWSTLSHTADMLEKLGIPYEVKVVSAHRTPDLLFQYADEAESRGIEV
IIAGAGGAAHLPGMCAAKTHLPVLGVPVQSSMLSGVDSLLSIVQMPAGIPVATLAIGKAG
AINAALLSASILGAKHPQFHAVLKKFRAEQTDSVLDNPDPRIA