Protein Info for GFF5493 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Glucose-6-phosphate 1-dehydrogenase (EC 1.1.1.49)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00871: glucose-6-phosphate dehydrogenase
  • amino acids 14 to 488 (475 residues), 568.9 bits, E=4.5e-175
• PF00479: G6PD_N
  • amino acids 17 to 190 (174 residues), 184.5 bits, E=3.1e-58
• PF02781: G6PD_C
  • amino acids 192 to 487 (296 residues), 412.3 bits, E=9.8e-128

Best Hits

Swiss-Prot: 52% identical to G6PD_RHIME: Glucose-6-phosphate 1-dehydrogenase (zwf) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00036, glucose-6-phosphate 1-dehydrogenase [EC: 1.1.1.49] (inferred from 71% identity to brh:RBRH_03664)

Predicted SEED Role

"Glucose-6-phosphate 1-dehydrogenase (EC 1.1.1.49)" in subsystem Entner-Doudoroff Pathway or Pentose phosphate pathway (EC 1.1.1.49)

MetaCyc Pathways

• aspartate superpathway (24/25 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (17/18 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (15/17 steps found)
• Entner-Doudoroff pathway I (9/9 steps found)
• L-lysine biosynthesis I (9/9 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• pentose phosphate pathway (7/8 steps found)
• L-lysine biosynthesis VI (6/7 steps found)
• superpathway of glucose and xylose degradation (13/17 steps found)
• L-lysine biosynthesis II (7/9 steps found)
• pentose phosphate pathway (oxidative branch) I (2/3 steps found)
• cytosolic NADPH production (yeast) (3/5 steps found)
• heterolactic fermentation (12/18 steps found)
• formaldehyde oxidation I (3/6 steps found)
• superpathway of NAD/NADP - NADH/NADPH interconversion (yeast) (4/8 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Glutathione metabolism
• Pentose phosphate pathway

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.49

Protein Sequence (491 amino acids)

>GFF5493 Glucose-6-phosphate 1-dehydrogenase (EC 1.1.1.49) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MVTSNTAPTPAEPLDLVIFGGVGDLSVRKLLPALYMAHLHRNLPEATRIHALGRQPWDRE
TFTAFIHDKVRAFIAPETLDETAWQGFVERLGYVCLDATQPADFTALAGALQPGSDRVYY
LATAPTLFTGICANLHGAGLIDERSRVVLEKPLGHDLASARAINDEVGRYFSEPQTFRID
HYLGKETVQNMMVLRFGNTIFEPLWRSPYIKSVQITVAESVGVGSRAGFYDGTGALRDMV
QNHLLQLLCIVAMEPPVSLDPDAVRDEKLKVLRSLRPMTEADVARDTVRGQYTAGASNGD
RAAGYLQEANVPADSTTETFVALRAHINNWRWANVPIFLRTGKRMAERRSEIVIEFADLP
YTIFPDAPRQPVNRLMIRLQPEEHVQLQMMAKEPGSGMRLRPVSLDLDLESAFSARRAEA
YERLLMDVIKGRLTHFMRRDELEAAWTWVEPILEGWSNLSEKPRPYTAGSWGPAASSALM
AREGSAWVEEA