Protein Info for PS417_28100 in Pseudomonas simiae WCS417

Updated annotation (from data): glucose-6-phosphate 1-epimerase [EC: 5.1.3.15]
Rationale: Specifically important for: D-Trehalose dihydrate; N-Acetyl-D-Glucosamine. NAG is phosphorylated by a PTS system, deacetylated (PS417_22985), and converted to fructose-6-phosphate by an aminotranferase (PS417_22990). One might expect the fructose-6-P to be converted to fructose-1,6-bisphosphate, but no gene for that is apparent in this organism or many other Pseudomonas (nor did the fitness data highlight any kinase). Instead, the fructose-6-phosphate is apparently converted to glucose-6-phosphate by the glucose-6-phosphate isomerase (PS417_23920) and oxidized by G6P dehydrogenase (PS417_22110). (Both of these genes are essential so we cannot confirm this.) G6P dehydrogenase is reportedly specific for the beta form, while G6P isomerase produces the alpha form of G6P, so it makes sense for a glucose-6-P epimerase to be involved (even though the reaction can occur spontaneously). This gene is also mildly important for trehalose utilization, which involves the hydrolysis of trehalose 6-phosphate to glucose-6-phosphate. Because trehalose has an alpha 1->1 linkage, the product is probably alpha-G6P. Thus, this gene's phenotypes are consistent with KEGG's annotation as glucose-6-phosphate 1-epimerase. (KEGG_correct)
Original annotation: aldose epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01263: Aldose_epim
  • amino acids 16 to 294 (279 residues), 144.3 bits, E=2.7e-46

Best Hits

KEGG orthology group: K01792, glucose-6-phosphate 1-epimerase [EC: 5.1.3.15] (inferred from 94% identity to pfs:PFLU6051)

Predicted SEED Role

"Aldose 1-epimerase"

KEGG Metabolic Maps

• Glycolysis / Gluconeogenesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.3.15

Sequence Analysis Tools

See A0A1N7UQW8 at UniProt or InterPro

Protein Sequence (299 amino acids)

>PS417_28100 glucose-6-phosphate 1-epimerase [EC: 5.1.3.15] (Pseudomonas simiae WCS417)
MPTPHVETVKIDELDCWRIRHNGAELIVAQQGAHLFSYGRDGEQPLIWPNPEAVFKKGKG
IRTGVPVCWPWFGVFDRNPQSVKAMRQSEQPAGAHGFVRTALWELAATELEGEALRVDLV
LPVPAGGFPGWPHQVDLTLSLLLDEQLHIRLTSHNRGTDTVTLSQALHTYFAVSDVRNAQ
VEGLDGRAYIDTADGWTEKTQSGLLHFTAETDRIYLDTPSQLTIVDKDWQRRIQLTSEGS
KSTVIWNPWTERAKAFDDMADDGWTGMLCIETANVLDDVVSLAPGESHTLGVSIAAIAL