Protein Info for PS417_02795 in Pseudomonas simiae WCS417

Annotation: acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13673: Acetyltransf_10
  • amino acids 52 to 151 (100 residues), 30.9 bits, E=3.5e-11
• PF00583: Acetyltransf_1
  • amino acids 53 to 143 (91 residues), 46.1 bits, E=8.5e-16
• PF13508: Acetyltransf_7
  • amino acids 64 to 144 (81 residues), 43.1 bits, E=7e-15

Best Hits

Swiss-Prot: 66% identical to TTR_PSEAJ: Acetyltransferase (ttr) from Pseudomonas amygdali pv. tabaci

KEGG orthology group: None (inferred from 94% identity to pfs:PFLU0580)

MetaCyc: 66% identical to tabtoxinine-beta-lactam acetyltransferase (Pseudomonas syringae)
2.3.1.-

Predicted SEED Role

"Tabtoxin resistance protein"

MetaCyc Pathways

• tabtoxinine-β-lactam biosynthesis (3/6 steps found)

Sequence Analysis Tools

See A0A1N7U9G7 at UniProt or InterPro

Protein Sequence (177 amino acids)

>PS417_02795 acetyltransferase (Pseudomonas simiae WCS417)
MNSAQVRRVNAESFAHYRLGLIELLLDAVRHGASVGFMADFDEAQAREYLRGVQASIEDA
GLLLWVVVRDEHVIASVQLALCQKANGLNRAEVQKLLVHSSARRHGLGQQLMNTLELAAR
QHKRGLLYLDTEAGSPAEAFYQSLRYIKVGELPDYCQSPDGRYSPTAIYFKTLGQPA