Protein Info for GFF5485 in Variovorax sp. SCN45

Annotation: Protein translocase subunit SecD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 626 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 452 to 473 (22 residues), see Phobius details amino acids 475 to 495 (21 residues), see Phobius details amino acids 498 to 518 (21 residues), see Phobius details amino acids 546 to 566 (21 residues), see Phobius details amino acids 572 to 595 (24 residues), see Phobius details PF13721: SecD-TM1" amino acids 1 to 108 (108 residues), 121.8 bits, see alignment E=4.1e-39 TIGR01129: protein-export membrane protein SecD" amino acids 128 to 595 (468 residues), 463.9 bits, see alignment E=5.1e-143 PF21760: SecD_1st" amino acids 234 to 293 (60 residues), 97 bits, see alignment 8.8e-32 PF22599: SecDF_P1_head" amino acids 317 to 426 (110 residues), 123.6 bits, see alignment E=9.4e-40 TIGR00916: protein-export membrane protein, SecD/SecF family" amino acids 356 to 588 (233 residues), 239.6 bits, see alignment E=3.4e-75 PF02355: SecD_SecF_C" amino acids 428 to 599 (172 residues), 77.4 bits, see alignment E=2.5e-25 PF03176: MMPL" amino acids 472 to 590 (119 residues), 36.5 bits, see alignment E=6.9e-13

Best Hits

KEGG orthology group: K03072, preprotein translocase subunit SecD (inferred from 94% identity to vap:Vapar_5119)

Predicted SEED Role

"Protein-export membrane protein SecD (TC 3.A.5.1.1)" (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (626 amino acids)

>GFF5485 Protein translocase subunit SecD (Variovorax sp. SCN45)
MNRYPVWKYTIIVIVLLVGLIYALPNFFGEAPAVQVSAAKTVVKVDASTQTRVEEALKAA
GLTPDLITLDGTSLRARFATTDDQLKARDAVQRALVPDANDPPYTVALNLVSRSPKWLTA
LHAFPMYLGLDLRGGVDFLLQVDMKGAIDKKAESFASDLRTTFRDKNIRGTAVSRNGQTV
EVSFRDAASLDAAKRLIQDQFQDLSTTDSQDGSNWRLVASIKPEAARRLQDAALKQNITT
LHNRINELGVAEPVIQQQGLDRIVVQLPGVQDTAKAKEILGRTATLEMRMVDESAEGRAA
ELGGGPVPFGSEKFLDRQGRPVIVKKQVLVTGENLTDAQPGFDQQSNQPKVDLTMDAKGG
RIMRDVSRENYKKRMAMLIFEKGKGEVLTAPSINGELGNRFQVSGSMTVVEANDLALLLR
AGSLAAPMEIIQERTIGPTLGADNIEKGFKSVMYGFLAIMVFMCAYYALFGLFSSIALAV
NLMLLVAILSMLQATLTLPGIAAMALAIGVAIDSNVLINERVREELRNGASPQAAIHAGY
ERAWGTILDSNVTTLIAGIALLAFGSGPVRGFAVVHCIGIVTSMFSAVFFSRGLVNFWYG
QKKKLKTVSIGTVWRPNTDGSAVATK