Protein Info for GFF5484 in Variovorax sp. SCN45

Annotation: Protein translocase subunit YajC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00739: preprotein translocase, YajC subunit
  • amino acids 23 to 104 (82 residues), 91.8 bits, E=1.1e-30
• PF02699: YajC
  • amino acids 26 to 101 (76 residues), 105.3 bits, E=6.3e-35

Best Hits

Swiss-Prot: 42% identical to YAJC_BRUME: Sec translocon accessory complex subunit YajC (yajC) from Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094)

KEGG orthology group: K03210, preprotein translocase subunit YajC (inferred from 97% identity to vpe:Varpa_5841)

MetaCyc: 38% identical to Sec translocon accessory complex subunit YajC (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Preprotein translocase subunit YajC (TC 3.A.5.1.1)" (TC 3.A.5.1.1)

Protein Sequence (111 amino acids)

>GFF5484 Protein translocase subunit YajC (Variovorax sp. SCN45)
LFISSAFAQTAPAAAGGGDMLSSLGSMLPLVLMFVVLYFVMIRPQMKRQKEARAMIEALA
KGDEVATAGGVLGKITSLNDQYLGLEIANGVEIKIQRSAVVQVLPKGAVKQ