Protein Info for PS417_28065 in Pseudomonas simiae WCS417

Annotation: transcriptional regulator PhoU

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 TIGR02135: phosphate transport system regulatory protein PhoU" amino acids 14 to 224 (211 residues), 262.6 bits, see alignment E=1.3e-82 PF01895: PhoU" amino acids 27 to 113 (87 residues), 91 bits, see alignment E=2.6e-30 amino acids 130 to 215 (86 residues), 74.3 bits, see alignment E=4.3e-25

Best Hits

Swiss-Prot: 91% identical to PHOU_PSEPU: Phosphate-specific transport system accessory protein PhoU homolog (phoU) from Pseudomonas putida

KEGG orthology group: K02039, phosphate transport system protein (inferred from 99% identity to pfs:PFLU6044)

Predicted SEED Role

"Phosphate transport system regulatory protein PhoU" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UEH8 at UniProt or InterPro

Protein Sequence (253 amino acids)

>PS417_28065 transcriptional regulator PhoU (Pseudomonas simiae WCS417)
MISKEGLTHHISAQFNAELEEVRSHLLAMGGLVEKQVNDAVTALIEADSGLAQQVREIDD
QINQMERNIDEECLRILARRQPAASDLRLIISISKSVIDLERIGDEATKIARRAIQLCEE
GEAPRGYVEVRHIGDQVRNMVRDALDAFARFDAELALSVAQYDKIIDREYKTALRELATY
MMEDPRSISRVLSIIWVLRSLERIGDHARNISELVIYLVRGTDVRHMGLKRMKAEVEGSA
DLIPNVPGESDDK