Protein Info for GFF5477 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Probable ferredoxin subunit of a ring-hydroxylating dioxygenase oxidoreductase protein (EC 1.-.-.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00355: Rieske
  • amino acids 9 to 95 (87 residues), 70.4 bits, E=1e-23
• PF13806: Rieske_2
  • amino acids 9 to 105 (97 residues), 45.3 bits, E=7.6e-16

Best Hits

Swiss-Prot: 57% identical to NAGAB_RALSP: Naphthalene 1,2-dioxygenase/salicylate 5-hydroxylase systems, ferredoxin component (nagAb) from Ralstonia sp.

KEGG orthology group: K14578, naphthalene 1,2-dioxygenase system ferredoxin subunit (inferred from 74% identity to aaa:Acav_0198)

MetaCyc: 63% identical to 2-nitrotoluene dioxygenase complex ferredoxin component (Acidovorax sp. JS42)
RXN-8819 [EC: 1.14.12.23]

Predicted SEED Role

"Probable ferredoxin subunit of a ring-hydroxylating dioxygenase oxidoreductase protein (EC 1.-.-.-)" (EC 1.-.-.-)

MetaCyc Pathways

• 2-nitrotoluene degradation (2/3 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Carotenoid biosynthesis - General
• Insect hormone biosynthesis
• Nucleotide sugars metabolism
• Porphyrin and chlorophyll metabolism
• Puromycin biosynthesis
• Trinitrotoluene degradation
• alpha-Linolenic acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.- or 1.14.12.23

Protein Sequence (109 amino acids)

>GFF5477 Probable ferredoxin subunit of a ring-hydroxylating dioxygenase oxidoreductase protein (EC 1.-.-.-) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MTTDNTLPWTDATAFDDVPDDDVTSVQLDGRDIALYKVEGSVFATDNTCTHGHARLCDGF
LEGHEIECPLHQGKFDVRDGSPTCAPVTEALRCYPVRIEDGRVFLQLPG