Protein Info for GFF5476 in Variovorax sp. SCN45

Annotation: ABC transporter, permease protein (cluster 3, basic aa/glutamine/opines)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 transmembrane" amino acids 29 to 51 (23 residues), see Phobius details amino acids 63 to 81 (19 residues), see Phobius details amino acids 85 to 105 (21 residues), see Phobius details amino acids 121 to 140 (20 residues), see Phobius details amino acids 192 to 211 (20 residues), see Phobius details amino acids 225 to 243 (19 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 22 to 99 (78 residues), 47.1 bits, see alignment E=1.4e-16 PF00528: BPD_transp_1" amino acids 66 to 250 (185 residues), 75.6 bits, see alignment E=2.2e-25

Best Hits

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 98% identity to vpe:Varpa_5849)

Predicted SEED Role

"Amino acid ABC transporter, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (256 amino acids)

>GFF5476 ABC transporter, permease protein (cluster 3, basic aa/glutamine/opines) (Variovorax sp. SCN45)
MEQPVLLFGWFRWDILVEYKDLFWQGAWMTLRMTVVCVLLGSSWGLCLALARLAQPRHAP
WTWVARFFLRWPATVYVSFFRGTPLFVQILLIHFAVMPVFIHPTSGLLIDGELARTLKQE
HGALISGVVALTLNSAAYISEVFRAGIQSISRGQFDAGRSLGFSPAQVMRYVVLPQAFRR
MLPPLGNNAIALLKDTSLVSAIGLAELAYAARTVAGAYARYWEPYLAISVIYWVMTLVLT
TLLRRLEIRLARSDRG