Protein Info for GFF5474 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Epoxyqueuosine (oQ) reductase QueG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 363 TIGR00276: epoxyqueuosine reductase" amino acids 14 to 357 (344 residues), 456.7 bits, see alignment E=2.1e-141 PF08331: QueG_DUF1730" amino acids 62 to 146 (85 residues), 76.8 bits, see alignment E=9.7e-26 PF13484: Fer4_16" amino acids 198 to 262 (65 residues), 83.6 bits, see alignment E=1.3e-27

Best Hits

Swiss-Prot: 76% identical to QUEG_ALIDK: Epoxyqueuosine reductase (queG) from Alicycliphilus denitrificans (strain DSM 14773 / CIP 107495 / K601)

KEGG orthology group: None (inferred from 77% identity to dia:Dtpsy_0900)

Predicted SEED Role

"Epoxyqueuosine (oQ) reductase QueG"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (363 amino acids)

>GFF5474 Epoxyqueuosine (oQ) reductase QueG (Hydrogenophaga sp. GW460-11-11-14-LB1)
MKFAFDAAQLVSQIQAWGQELAFSQIGVAGVDLSAAEPGLLAWLSAGWHGDMAYMAAHGL
KRARPAELVPGTLSVITARMDYLPRGTPEDWQALELQRLERPGEAVVSVYARGRDYHKVL
RSRLQTLSERIQAAAGPLGHRVFTDSAPVLEAELAQRSGQGWRGKHTLLLNREAGSMFFL
GEIYTDLPLPPTEPISAHCGACRACIDICPTQAITAPHRLDARRCISYLTIEHAGPIPEA
LRPLIGNRIYGCDDCQLVCPWNKFARRSPLPDFDAREGLSGATLLELFAWSEDEFLRRTE
GSPIRRIGHERWLRNIAVALGNALRSGPDEAMLRALQARADHPSELVREHVAWAMAQGLA
AIP