Protein Info for GFF547 in Xanthobacter sp. DMC5

Annotation: ATM1-type heavy metal exporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 651 transmembrane" amino acids 42 to 64 (23 residues), see Phobius details amino acids 85 to 107 (23 residues), see Phobius details amino acids 171 to 192 (22 residues), see Phobius details amino acids 198 to 217 (20 residues), see Phobius details amino acids 282 to 305 (24 residues), see Phobius details amino acids 312 to 335 (24 residues), see Phobius details PF00664: ABC_membrane" amino acids 43 to 326 (284 residues), 112.8 bits, see alignment E=2.4e-36 PF00005: ABC_tran" amino acids 391 to 540 (150 residues), 116.9 bits, see alignment E=1e-37

Best Hits

Swiss-Prot: 52% identical to ATM1_NOVAD: ATM1-type heavy metal exporter (atm1) from Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CIP 105152 / NBRC 16084 / F199)

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 86% identity to xau:Xaut_4185)

Predicted SEED Role

"Lipid A export ATP-binding/permease protein MsbA" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (651 amino acids)

>GFF547 ATM1-type heavy metal exporter (Xanthobacter sp. DMC5)
MSQSQKPAARRAAVSSDAMFSTLRGLWPYLWPADRADLRARVVVTFVLLFASKGATMAVP
FLFKWATDALTAEVAAGKAATPDVGFWALVIGAPVALTLAYGLGRILMAGVTQLRDGLFA
KVALNAVRRLAMETFEHMHALSLRFHLERKTGGLTRVLERARSGIETIVRMLALQLAPTI
VELVMVLGVLLFAFDWRYVAVVSATVVLYSLFTYVASEWRLAIRKEMNESDTDANTKAID
SLLNYETVKYFGAERWETARYDRSMARYEKATVNTYTSLAWLNAGQALIFSIGLAAVMVM
CVLDIRAGRQTVGSFVMVNAMMIQFYIPLNFLGFIYREIKQAIVDIEAMFAVLQVAPEVT
DRPGAPDLVVSGGTVRFEDVRFSYDAGREILKGISFEVPAGRTVAIVGPSGAGKSTLSRL
LFRFYDVSGGRITIDGQDLREVSQESLRAAIGMVPQDTVLFNDTIAYNIRYGRPAASEAE
VEEAARLARIDGFIRATPKGFKTEVGERGLKLSGGEKQRVAIARTLLKAPPILVLDEATS
ALDSHTEKEIQDALDRVSEGRTTLVIAHRLSTVVSADEILVLADGKVAERGCHAELLAKG
GLYAALWNRQREAEDAAAVLARAQAEEALEALPARHPDEEGMDEERVRAVG