Protein Info for GFF5463 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: putative membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 311 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 46 to 61 (16 residues), see Phobius details amino acids 70 to 91 (22 residues), see Phobius details amino acids 103 to 125 (23 residues), see Phobius details amino acids 133 to 154 (22 residues), see Phobius details amino acids 173 to 194 (22 residues), see Phobius details amino acids 201 to 223 (23 residues), see Phobius details amino acids 228 to 249 (22 residues), see Phobius details amino acids 259 to 278 (20 residues), see Phobius details amino acids 286 to 309 (24 residues), see Phobius details PF03547: Mem_trans" amino acids 156 to 304 (149 residues), 61.4 bits, see alignment E=5.8e-21 PF01758: SBF" amino acids 233 to 307 (75 residues), 31.1 bits, see alignment E=1.9e-11

Best Hits

KEGG orthology group: K07088, (no description) (inferred from 74% identity to pol:Bpro_3195)

Predicted SEED Role

"putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (311 amino acids)

>GFF5463 putative membrane protein (Hydrogenophaga sp. GW460-11-11-14-LB1)
VPACGYALTVNFAQLLFPDFSLILCGYLVCRFTALNRKVWEQVESLVYYFLFPVLLFHSI
VKSPLDLSAASSLMGAGIALGVAGIALSYSLPHWPWLGPKLDVRLHAASAQVGFRFNSFI
ALALADKVAGPQGLLMIAVLIGVCVPLFNVGAVWPMARHANKGFGRELLRNPLIIGTLGG
LIANLLGFSIPFWLEPTVNRIGQASLALGLLAAGAGMQFGMLASAKLLGGMVLACKHLGM
PLLAFGLAKLFRLDPTQTTVLLMFSAVPTASSCYVLAARMGYNGPYVAGLVTLSTLLGIV
SLPFALGVLGG