Protein Info for GFF546 in Variovorax sp. SCN45

Annotation: Aspartokinase (EC 2.7.2.4)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 422 TIGR00657: aspartate kinase" amino acids 1 to 415 (415 residues), 429.9 bits, see alignment E=1.3e-132 TIGR00656: aspartate kinase, monofunctional class" amino acids 1 to 417 (417 residues), 412.7 bits, see alignment E=1.7e-127 PF00696: AA_kinase" amino acids 3 to 234 (232 residues), 177.2 bits, see alignment E=8.9e-56 PF22468: ACT_9" amino acids 278 to 336 (59 residues), 29.4 bits, see alignment E=1.1e-10 amino acids 357 to 415 (59 residues), 91.5 bits, see alignment E=4.3e-30 PF01842: ACT" amino acids 281 to 335 (55 residues), 29.1 bits, see alignment 1.3e-10 amino acids 359 to 398 (40 residues), 29.1 bits, see alignment 1.3e-10 PF13840: ACT_7" amino acids 353 to 413 (61 residues), 62.4 bits, see alignment E=6e-21

Best Hits

KEGG orthology group: K00928, aspartate kinase [EC: 2.7.2.4] (inferred from 97% identity to vap:Vapar_3086)

Predicted SEED Role

"Aspartokinase (EC 2.7.2.4)" in subsystem Lysine Biosynthesis DAP Pathway or Threonine and Homoserine Biosynthesis (EC 2.7.2.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.2.4

Use Curated BLAST to search for 2.7.2.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (422 amino acids)

>GFF546 Aspartokinase (EC 2.7.2.4) (Variovorax sp. SCN45)
MALIVHKYGGTSMGSTERIKNVAKRVAKWARAGHQMIVVPSAMSGETNRLLGLAKELAPS
KPGVAHNRELDMLASTGEQASSALLAIALQAEGVESVSYAGWQVSVRTDNSYTKARIESI
DDARVMADLNAGKVVVITGFQGVDDDGNITTLGRGGSDTSAVAIAAAMKANECLIYTDVD
GVYTTDPRVEPDARRLTTVSFEEMLEMASLGSKVLQIRSVEFAGKYKVPLRVLSSFTPWD
IDINEEAKSGTLITFEEDENMEQAVVSGIAFNRDEAKISVLGVPDKPGIAYHILGAVADA
NIEVDVIIQNLSKDGKTDFSFTVHRNEYAKTVDLLQSKVMPSLGATEIVGDTKICKVSIV
GIGMRSHVGVASKMFRVLSEEGINIQMISTSEIKTSVVIDEKYMELAVRALHKAFDLDQP
SA