Protein Info for PS417_27925 in Pseudomonas simiae WCS417

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 429 transmembrane" amino acids 159 to 177 (19 residues), see Phobius details amino acids 228 to 248 (21 residues), see Phobius details TIGR03349: type IV/VI secretion system protein, DotU family" amino acids 46 to 255 (210 residues), 247.1 bits, see alignment E=1.5e-77 PF09850: DotU" amino acids 47 to 249 (203 residues), 237.4 bits, see alignment E=1.3e-74 TIGR03350: type VI secretion system peptidoglycan-associated domain" amino acids 287 to 423 (137 residues), 169.6 bits, see alignment E=3.5e-54 PF00691: OmpA" amino acids 319 to 417 (99 residues), 53.4 bits, see alignment E=2.8e-18

Best Hits

KEGG orthology group: K11892, type VI secretion system protein ImpK (inferred from 99% identity to pfs:PFLU6014)

Predicted SEED Role

"Outer membrane protein ImpK/VasF, OmpA/MotB domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UU25 at UniProt or InterPro

Protein Sequence (429 amino acids)

>PS417_27925 hypothetical protein (Pseudomonas simiae WCS417)
MHPNDDDRTQFMPRPGGRAPEPARAEPAPLAMPAAPMLTGKSQGLNPLESAAGPLLALLT
RLRNTIAHPAPASLRAQLLAYLRQFEERAEAAGIARNEVLLARYALCTALDEAVLSTPWG
STSDWGKQSLLITVHNEAWGGEKVFQLLDHCLQSPRERLYLLELLYLCMCLGFEGRYRVM
NDGRSQLETLRERTAAAIRSARGEHERELSPHWRGVTVARDRLAQFMPPWIAVAIGVALL
LALLFGLRLKLASDAEPVFKNIHALGEIPVQAIDRPVAQPKVIERPRLAGFLVEDIKAGR
VAVEDAVDRSVVTIRGDELFASASSSIVDDYQPLMLRIADAIRKVKGQVRVTGHSDNRPI
ATLRFPSNWALSEARAKSVLEILAAKTGQADRFSAEGRSDTEPVATNATAEGRARNRRVE
ITVLAEGVE