Protein Info for GFF545 in Sphingobium sp. HT1-2

Annotation: 4-hydroxy-2-oxovalerate aldolase (EC 4.1.3.39)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 345 TIGR03217: 4-hydroxy-2-oxovalerate aldolase" amino acids 9 to 340 (332 residues), 567.2 bits, see alignment E=6e-175 PF00682: HMGL-like" amino acids 10 to 267 (258 residues), 201.9 bits, see alignment E=1.3e-63 PF07836: DmpG_comm" amino acids 278 to 339 (62 residues), 110.6 bits, see alignment E=2.1e-36

Best Hits

Swiss-Prot: 84% identical to HOA3_SPHWW: 4-hydroxy-2-oxovalerate aldolase 3 (Swit_4923) from Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273)

KEGG orthology group: K01666, 4-hydroxy 2-oxovalerate aldolase [EC: 4.1.3.39] (inferred from 84% identity to swi:Swit_4923)

MetaCyc: 73% identical to 4-hydroxy-2-oxovalerate aldolase (Pseudomonas putida)
4-hydroxy-2-oxovalerate aldolase. [EC: 4.1.3.39]

Predicted SEED Role

"4-hydroxy-2-oxovalerate aldolase (EC 4.1.3.39)" (EC 4.1.3.39)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.3.39

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (345 amino acids)

>GFF545 4-hydroxy-2-oxovalerate aldolase (EC 4.1.3.39) (Sphingobium sp. HT1-2)
MPFDPTETKLYIQDVTLRDGMHAIRHQYGLDHVQAIARALDVAKVDAIEVSHGDGLNGSS
FNYGFGRHTDWEWIEAVADVLDHSVLTTLLIPGIGTIEDLKHAHGLGVRSVRVATHCTEA
DVARQHIGAARDLGMDVSGFLMMSHMIDPDALAQQARLMESYGAHCIYVTDSGGALDMDG
YRARCEAYDRVLKPETQRGIHAHHNLSLGVANSIVGVQAGAIRVDASLAGMGAGAGNAPL
EVFIAAAARKGWNHGCDLYRLMDAAETLVRPLQDRPVRVDRETLSLGYAGVYSSFLRHAE
KASADYGIDTREILVELGRRRMVGGQEDMIVDVALDLARASARTA