Protein Info for GFF5445 in Variovorax sp. SCN45

Annotation: FIG003879: Uncharacterized subgroup of the nitrilase superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00795: CN_hydrolase
  • amino acids 2 to 260 (259 residues), 188.1 bits, E=9.9e-60

Best Hits

KEGG orthology group: K01501, nitrilase [EC: 3.5.5.1] (inferred from 93% identity to vpe:Varpa_5874)

Predicted SEED Role

"FIG003879: Predicted amidohydrolase"

MetaCyc Pathways

• indole-3-acetate biosynthesis V (bacteria and fungi) (1/1 steps found)
• indole glucosinolate activation (herbivore attack) (8/13 steps found)
• indole-3-acetate biosynthesis II (5/12 steps found)

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Cyanoamino acid metabolism
• Nitrogen metabolism
• Styrene degradation
• Tryptophan metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.5.1

Protein Sequence (271 amino acids)

>GFF5445 FIG003879: Uncharacterized subgroup of the nitrilase superfamily (Variovorax sp. SCN45)
MKVAAIQMVSAIAREANLARAHDLLAQAAEAGAELAVLPEYFCMMGARDTDKLGLRETAG
AGTVQGFLADAAREFGLWIVGGTLPIESNDAEHVFNSSLAFSPEGRCVARYDKIHLFFFD
NGTERYDERRVIAPGAEPVVFELPSRDGHAWRVGMSVCYDLRFPELYRALAKKGADLLLV
PSAFTRTTGAAHWEVLLRARAIENLAWVVAPAQGGTHENGRQTWGQSLVVDPWGTVVAQQ
ATEEGVVLFDIDAGQVARTRTQLPVLSHSVL