Protein Info for GFF5445 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: 33 kDa chaperonin (Heat shock protein 33) (HSP33)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 PF01430: HSP33" amino acids 3 to 303 (301 residues), 252.2 bits, see alignment E=3.4e-79

Best Hits

KEGG orthology group: K04083, molecular chaperone Hsp33 (inferred from 75% identity to pna:Pnap_1179)

Predicted SEED Role

"33 kDa chaperonin (Heat shock protein 33) (HSP33)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (325 amino acids)

>GFF5445 33 kDa chaperonin (Heat shock protein 33) (HSP33) (Hydrogenophaga sp. GW460-11-11-14-LB1)
VSELHKFVFEGLPVRGMLVRLTDAWQEILQRHRDAGGYPAAVTELLGEMTAAATLMQANI
KFNGALIMQIMGDGPVKLAVAEVQPDLSLRATATVVGEVAADAPLSHMVNATNQGRCAIT
LDPKDRLPGQQPYQGVVPLFGDKREKLEKLSEVIEHYMLQSEQLDTRLVLAADDKMAAGL
LIQRLPLQGVDNLAGQSGARDEDQIGVNEDYNRIAILAASLKREELLGLDADTILHRLFW
EEDLRRFEPLTGEQGPRFACTCSRERVGSMLRSLGRDEVESILAEQGQVEVGCEFCGAQY
RFDPVDAAQVFLQPAQQAPASDQKH