Protein Info for PS417_27850 in Pseudomonas simiae WCS417

Annotation: biopolymer transporter ExbB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 signal peptide" amino acids 1 to 40 (40 residues), see Phobius details transmembrane" amino acids 109 to 131 (23 residues), see Phobius details amino acids 217 to 239 (23 residues), see Phobius details amino acids 260 to 283 (24 residues), see Phobius details TIGR02797: tonB-system energizer ExbB" amino acids 98 to 307 (210 residues), 348 bits, see alignment E=1.1e-108 PF01618: MotA_ExbB" amino acids 174 to 290 (117 residues), 111.1 bits, see alignment E=1.6e-36

Best Hits

Swiss-Prot: 77% identical to EXBB_PSEPU: Biopolymer transport protein ExbB (exbB) from Pseudomonas putida

KEGG orthology group: K03561, biopolymer transport protein ExbB (inferred from 94% identity to pfs:PFLU5999)

Predicted SEED Role

"MotA/TolQ/ExbB proton channel family protein" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UH97 at UniProt or InterPro

Protein Sequence (326 amino acids)

>PS417_27850 biopolymer transporter ExbB (Pseudomonas simiae WCS417)
MTRNTTPASPTKLHSPSRAWRAIAALLFSVLLAPTAAFADATAPATPAAAEQNAAAPAAP
AAAPAATDPAQAADPASADETGVVLEGDNTLGMAHDLSPWGMYQNADVVVKAVMIGLAIA
SIITWTIWIAKGFELLGAKRRLRNEIVHLKKATTLKEASESATKKGTLANTLVHDALEEM
RLSANTREKEGIKERVAFRLERLVAACGRNMSSGTGVLATIGSTAPFVGLFGTVWGIMNS
FIGIAKTQTTNLAVVAPGIAEALLATALGLVAAIPAVVIYNVFARSIAGYKAQVSDASAE
VLLLVSRDLDHLPTERSSQPHMVKVG