Protein Info for GFF5441 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase (EC 2.5.1.55)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 PF00793: DAHP_synth_1" amino acids 7 to 271 (265 residues), 238.7 bits, see alignment E=2.9e-75 TIGR01362: 3-deoxy-8-phosphooctulonate synthase" amino acids 13 to 275 (263 residues), 406.3 bits, see alignment E=2.2e-126

Best Hits

Swiss-Prot: 92% identical to KDSA_VARPS: 2-dehydro-3-deoxyphosphooctonate aldolase (kdsA) from Variovorax paradoxus (strain S110)

KEGG orthology group: K01627, 2-dehydro-3-deoxyphosphooctonate aldolase (KDO 8-P synthase) [EC: 2.5.1.55] (inferred from 90% identity to aaa:Acav_1343)

MetaCyc: 46% identical to 3-deoxy-D-manno-octulosonate 8-phosphate synthase (Escherichia coli K-12 substr. MG1655)
3-deoxy-8-phosphooctulonate synthase. [EC: 2.5.1.55]

Predicted SEED Role

"2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase (EC 2.5.1.55)" in subsystem KDO2-Lipid A biosynthesis (EC 2.5.1.55)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.55

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (285 amino acids)

>GFF5441 2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase (EC 2.5.1.55) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MKLCDFDIGLDRPFFLIAGPCVIESEQLQMDVAGQLKEITGSLGVPFIFKSSFDKANRSS
GTSYRGPGRDKGLEILAKVKRELGVPVLTDVHSEDDITDAAKVCDVLQTPAFLCRQTDFI
RAVAQSGKPVNIKKGQFLAPHDMKNVIDKARAAAKEAGLDEDRFMACERGASFGYNNLVS
DMRGLAIMRETGAPVVFDATHSVQLPGGQGTSSGGQREMVPVLARAAVAVGVAGLFMETH
PDPAKALSDGPNAVPLKHMKALLETLLALDTVTKKNGFLEDRFNA