Protein Info for PS417_02770 in Pseudomonas simiae WCS417

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 transmembrane" amino acids 9 to 28 (20 residues), see Phobius details amino acids 32 to 50 (19 residues), see Phobius details amino acids 62 to 88 (27 residues), see Phobius details amino acids 149 to 168 (20 residues), see Phobius details amino acids 181 to 199 (19 residues), see Phobius details amino acids 205 to 227 (23 residues), see Phobius details amino acids 233 to 251 (19 residues), see Phobius details amino acids 256 to 278 (23 residues), see Phobius details amino acids 300 to 326 (27 residues), see Phobius details PF01594: AI-2E_transport" amino acids 16 to 329 (314 residues), 34.7 bits, see alignment E=5.8e-13

Best Hits

KEGG orthology group: None (inferred from 98% identity to pfs:PFLU0573)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UC36 at UniProt or InterPro

Protein Sequence (337 amino acids)

>PS417_02770 membrane protein (Pseudomonas simiae WCS417)
MPTFSQRHVILLASYIIIFGGLLLVLPLKLLPSLLAGLLVFELVNMLTPQLQRLIEGRRA
RWLAVALLGTLIVSVLTLIFAGAISFLLHEAENPGASLDKFMGVVDRARGQLPPFIDAYL
PASAAEFRVAIGDWMSKHLSELQLVGKDAAHMFVTLLIGMVLGAIIALQRVPDLTKRKPL
AAVLFDRLHLLVQAFRNIVFAQIKIAALNTAFTAVFLAVVLPLCGIHLPLTKTLIVLTFL
LGLLPVIGNLMSNTLITIVALSLSIWVAVAALGYLIVIHKVEYFLNARIVGGQISAKSWE
LLLAMLVFEAAFGLPGVVAGPIYYAYLKSELKLGGMV