Protein Info for GFF5431 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Vitamin B12 ABC transporter, permease component BtuC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 332 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 62 to 83 (22 residues), see Phobius details amino acids 92 to 111 (20 residues), see Phobius details amino acids 116 to 135 (20 residues), see Phobius details amino acids 144 to 167 (24 residues), see Phobius details amino acids 175 to 190 (16 residues), see Phobius details amino acids 196 to 214 (19 residues), see Phobius details amino acids 235 to 264 (30 residues), see Phobius details amino acids 275 to 294 (20 residues), see Phobius details amino acids 306 to 325 (20 residues), see Phobius details PF01032: FecCD" amino acids 12 to 326 (315 residues), 284.4 bits, see alignment E=1e-88 PF00950: ABC-3" amino acids 96 to 287 (192 residues), 20.2 bits, see alignment E=3.8e-08

Best Hits

KEGG orthology group: K02015, iron complex transport system permease protein (inferred from 69% identity to met:M446_0418)

Predicted SEED Role

"Vitamin B12 ABC transporter, permease component BtuC" in subsystem Coenzyme B12 biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (332 amino acids)

>GFF5431 Vitamin B12 ABC transporter, permease component BtuC (Hydrogenophaga sp. GW460-11-11-14-LB1)
MKGGGLWAGAVLLAGLLLALTQGRIDIPLGDLVQWVAALLQGAPAPNEQVQTIVLQVRGP
RALAALAVGAALAVAGAAFQGLFRNPLVSPDILGASAGAALGAVLGIFFSFGVFGIQMAA
FAGGLLAVALVYGVGSTVRHGDPVLVLLLAGIVIGSLLGAGIGLVKVLADPYNQLPAMTF
WLLGSLAAAHADDLPSLIVPVAVGTVVLLLLRWRMDVMSLPEDEARSLGARTTGLRLLIV
AAATLVTAASVAAAGIVGWVGLVVPHLARFLVGPSFVRLLPTSAVLGGGLLLLIDTLART
LAPVEIPLGILTALIGSPFFIVLLRRASRGWT