Protein Info for GFF5429 in Variovorax sp. SCN45

Annotation: Iron(III) dicitrate transport protein FecA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 723 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details PF07715: Plug" amino acids 58 to 171 (114 residues), 76.1 bits, see alignment E=2.9e-25 TIGR01783: TonB-dependent siderophore receptor" amino acids 59 to 723 (665 residues), 314.2 bits, see alignment E=1.1e-97 PF00593: TonB_dep_Rec_b-barrel" amino acids 262 to 691 (430 residues), 171 bits, see alignment E=8.2e-54

Best Hits

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 82% identity to vap:Vapar_5169)

Predicted SEED Role

"Iron(III) dicitrate transport protein FecA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (723 amino acids)

>GFF5429 Iron(III) dicitrate transport protein FecA (Variovorax sp. SCN45)
LNTHRHRHKRTAIALALLPLSLQGFAAEAQPAAEPSKSLEAITVTGDWLGTPSEAKVLEH
AGARTIIERKQIQESGSASVRDVLRQVPGVQVQESNGTGGSDISLNVGVRGLTSRLSPRS
TVLLDGVPLAYAPYGQPQLSLAPLSLGNLEAVDVVRGAGSVRYGPQNVGGIINFVSRAIP
STFAEEASVGVESAGHGGGIKTTPSVFIGGTNENGLGLALLYSGTHGDGWRQSNDRTSID
DLMLKGAYRLSKTDDIAVSLHHFEGQGTMPGGLTTAQFAANPFQSDRPFDEFTGRRTDGS
IKYTHNDGVNKFELLTYYTDSFRGSHIEQEGSGTTAGQRRLTAAPRSYKTFAVEPRYSRL
FDSGSVVQEVSVGYRYLKEDTQETATRSAYYRPRPGFDAYSLANPAYQTSKGGTTAHAFY
IDDRIDFGNWTVTPGVRYESIRSFNDVINLTNGRVTGALQPKADANEVLPTLSVMYRMNE
RWSLFANAGVSFGPQQYAQLAQSTNGLHAEKANTYEIGTHYKSEALSGELTLFNIDFDKE
LQLARSIVGDGQWTDLGATQHRGLESALRYELAELNPSLKGMSVSATYTYTQAISKAGVF
AGRDLPFYSRNVATLGARYERGPWTFNADLYAQSKQRSPGSPDTGAIYITQEDATGRLGN
IPGYALVNLRAGYDFGKNMRNLKVAVGVKNLFDRRYFNRSVDNNGGKYVGQPRTLYVQAS
VAF