Protein Info for GFF5420 in Variovorax sp. SCN45

Annotation: Cyclic pyranopterin monophosphate synthase (EC 4.6.1.17)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 161 TIGR00581: molybdenum cofactor biosynthesis protein C" amino acids 4 to 155 (152 residues), 197 bits, see alignment E=6.8e-63 PF01967: MoaC" amino acids 15 to 153 (139 residues), 187.4 bits, see alignment E=5.9e-60

Best Hits

Swiss-Prot: 91% identical to MOAC_VARPS: Cyclic pyranopterin monophosphate synthase (moaC) from Variovorax paradoxus (strain S110)

KEGG orthology group: K03637, molybdenum cofactor biosynthesis protein C (inferred from 94% identity to vpe:Varpa_5898)

Predicted SEED Role

"Molybdenum cofactor biosynthesis protein MoaC" in subsystem Molybdenum cofactor biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (161 amino acids)

>GFF5420 Cyclic pyranopterin monophosphate synthase (EC 4.6.1.17) (Variovorax sp. SCN45)
MSTLTHFDAQGQAHMVDVAGKASTHRVAVATGRIEMQAATLALIESGTAKKGDVLGIARI
AGIQAAKKTSDLIPLCHPLALTRVAVAFALDADAGSAPRVVCTATVETVGPTGVEMEALA
AVQVALLTVYDMCKAVDRGMRITDVHVLEKHGGKSGSWVAG