Protein Info for GFF542 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Oligopeptide ABC transporter, periplasmic oligopeptide-binding protein OppA (TC 3.A.1.5.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 431 PF13416: SBP_bac_8" amino acids 61 to 340 (280 residues), 63.2 bits, see alignment E=3.5e-21 PF13343: SBP_bac_6" amino acids 177 to 362 (186 residues), 25.8 bits, see alignment E=7.3e-10

Best Hits

KEGG orthology group: K02055, putative spermidine/putrescine transport system substrate-binding protein (inferred from 93% identity to pna:Pnap_3269)

Predicted SEED Role

"Oligopeptide ABC transporter, periplasmic oligopeptide-binding protein OppA (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) or Sex pheromones in Enterococcus faecalis and other Firmicutes (TC 3.A.1.5.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (431 amino acids)

>GFF542 Oligopeptide ABC transporter, periplasmic oligopeptide-binding protein OppA (TC 3.A.1.5.1) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MSHTDHDAPAPSAPTGLSRRSLLQGTAGMAGILATGLAPAVHAQDKIVLRYLGTAVNQDK
AIAEKFKADTGIEIQYVAVTTDDVTKRAVTAPNSFDLIDTEYFSLKKIVPTGNLKGIDTK
KIKNADKITPLFTTGTVAGKAVGDQGTAPKKVIFLEGEKSKVFAKSPTQFMSLIPTVYNA
DTLGIRPDLIKRPIESWAELLNPEFKGKAAILNIPSIGIMDAAMVVEAKGIHKYKDKGNM
SKAEIDLTIKTLIEAKKAGQFRALWKDFNESVNLMASGEVVIQSMWSPAVTAVRTKGIAC
NFQPLKEGYRAWAAGFGLPATLSGRKLDGAYEFINWFLDGWAGAYLNRQGYYSAVLDTAK
AKMEAYEWAYWMEGKPASQDIKSPNGDVLAKAGAVRDGGSYEARMGGIACWNAVMDENEY
MVRKWNEFVAA