Protein Info for GFF5414 in Variovorax sp. SCN45

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 161 transmembrane" amino acids 15 to 41 (27 residues), see Phobius details PF07963: N_methyl" amino acids 10 to 34 (25 residues), 33.3 bits, see alignment 2.6e-12 TIGR01708: type II secretion system protein H" amino acids 10 to 81 (72 residues), 46.8 bits, see alignment E=2.8e-16 TIGR02532: prepilin-type N-terminal cleavage/methylation domain" amino acids 11 to 34 (24 residues), 31.2 bits, see alignment 1.3e-11 PF12019: GspH" amino acids 49 to 147 (99 residues), 36.3 bits, see alignment E=6.7e-13

Best Hits

KEGG orthology group: K08084, type IV fimbrial biogenesis protein FimT (inferred from 58% identity to del:DelCs14_3851)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (161 amino acids)

>GFF5414 hypothetical protein (Variovorax sp. SCN45)
MKNLTLSSREQEGFTLIEMMVVVVLVAILAALAMPSFTAMIANQRVTSAAQELQTLLQYA
RAEGVYKRTQSTVTATDQTWQAKAGTQVLREATLSDSVTVEAGSSGGVIFEATGQARPAS
GGGTLYSVSISGTNASRVQCLTVTGAGLVRLKSAATKQDCS