Protein Info for GFF5406 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Coenzyme PQQ synthesis protein D

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03859: coenzyme PQQ biosynthesis protein PqqD
  • amino acids 8 to 86 (79 residues), 95.3 bits, E=7.9e-32
• PF05402: PqqD
  • amino acids 25 to 86 (62 residues), 53.5 bits, E=1.2e-18

Best Hits

Swiss-Prot: 47% identical to PQQD_METCA: PqqA binding protein (pqqD) from Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)

KEGG orthology group: K06138, pyrroloquinoline quinone biosynthesis protein D (inferred from 54% identity to rpi:Rpic_0291)

Predicted SEED Role

"Coenzyme PQQ synthesis protein D" in subsystem Coenzyme PQQ synthesis or Pyrroloquinoline Quinone biosynthesis

Protein Sequence (87 amino acids)

>GFF5406 Coenzyme PQQ synthesis protein D (Hydrogenophaga sp. GW460-11-11-14-LB1)
MNTLSNHPRLSRRFRLQYEPAQERWVLLYPEGMVQLNESAAEILKRCDGERTVAAIVEEL
ETTFFIQGIGRQVKDLIEEGGRRGWID