Protein Info for GFF540 in Variovorax sp. SCN45

Annotation: Permease of the drug/metabolite transporter (DMT) superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 47 to 65 (19 residues), see Phobius details amino acids 78 to 99 (22 residues), see Phobius details amino acids 111 to 128 (18 residues), see Phobius details amino acids 135 to 155 (21 residues), see Phobius details amino acids 161 to 182 (22 residues), see Phobius details amino acids 193 to 212 (20 residues), see Phobius details amino acids 224 to 246 (23 residues), see Phobius details amino acids 253 to 274 (22 residues), see Phobius details amino acids 280 to 296 (17 residues), see Phobius details PF00892: EamA" amino acids 19 to 151 (133 residues), 40.6 bits, see alignment E=1.6e-14 amino acids 163 to 294 (132 residues), 67.5 bits, see alignment E=7.5e-23

Best Hits

KEGG orthology group: None (inferred from 42% identity to amr:AM1_0254)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (300 amino acids)

>GFF540 Permease of the drug/metabolite transporter (DMT) superfamily (Variovorax sp. SCN45)
MTTSIALPATSKNSLFSFVALFLGAAALALGGVFLRHSELPPTASAVYRVALAIPIFFLL
DMLAARSEPAQPAERRPLIPVKLILVGFIFSGNLALYHWSMTLTTLANSNLLANLAPIFV
VLGSNLFLGKKFNSGFLFGMLFALAGAFILIGHRLDFGSSYMAGNLLGLLTAVFYGSYLL
AVSLVRSNYRTMTVMAWSSVGTLIVLLPITLLRGESLVPHTLHGMLMLLALALISHVGGQ
GLIAYALAKLPAALSSITLLIQPVIATVLGAYLFHEYLSVTEFVGGVIILVGIVTARKFS