Protein Info for GFF540 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Putrescine transport system permease protein potI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 transmembrane" amino acids 12 to 38 (27 residues), see Phobius details amino acids 74 to 97 (24 residues), see Phobius details amino acids 108 to 131 (24 residues), see Phobius details amino acids 163 to 185 (23 residues), see Phobius details amino acids 206 to 228 (23 residues), see Phobius details amino acids 262 to 287 (26 residues), see Phobius details PF00528: BPD_transp_1" amino acids 88 to 281 (194 residues), 41.2 bits, see alignment E=7.6e-15

Best Hits

KEGG orthology group: K02053, putative spermidine/putrescine transport system permease protein (inferred from 85% identity to vap:Vapar_3536)

Predicted SEED Role

"Putrescine transport system permease protein potI"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (297 amino acids)

>GFF540 Putrescine transport system permease protein potI (Hydrogenophaga sp. GW460-11-11-14-LB1)
MPRFKEPRAAGFWPLAIVFALFVLFMYGPMAVIFVLSFQGPEGGLTFPLRGVSLHWFHKL
AEGLGTVDIGAAFLRSLMLGGVVMLFTVLLSVLAGLAFRKPLRGANALFYVTVASLIMPS
IIVSLGIGLQFRLLDGALKGLLEAVDATGTLENYGTALGLLTSALGAHLTWTLPFGLLIM
FAVFNRFNPAYEEAARDLGATPWQGFRHVVLPLIGPSVVGIGMFGFTLSWDEIARTSQAI
GDVNTLPLELQGLTSTVTTPAIYALGTVTTVVSLLVMGVAVSLALWLGRRQKKGRSA