Protein Info for GFF5399 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: autotransporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 743 TIGR02601: autotransporter-associated beta strand repeat" amino acids 240 to 271 (32 residues), 27.9 bits, see alignment (E = 1.5e-10) TIGR01414: outer membrane autotransporter barrel domain" amino acids 312 to 743 (432 residues), 143.8 bits, see alignment E=7.9e-46 PF18883: AC_1" amino acids 313 to 407 (95 residues), 32.1 bits, see alignment E=1e-11 PF03797: Autotransporter" amino acids 472 to 717 (246 residues), 123.2 bits, see alignment E=1.7e-39

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (743 amino acids)

>GFF5399 autotransporter (Hydrogenophaga sp. GW460-11-11-14-LB1)
VAGGSLVLQPGATYGTAGNLLVGSTAGTMGTLTVQGAGARARVTLLQSLAGEAHIRVLDG
GVLNSTGPSGVRLGGTSATVSNGGVAHVLVSGSGSALTSAVSYLHQRGTLEVSNGGRLEA
AAGIQLGSMPGGFTGVVTGAGSQLGTTLAAITLGASGTASLRVSDGGLLSANGGAAALNL
ATNVGGVATLNIGAAAGDAAIAPGTVLAAAVNGGAGTAVLNFNHNASAYDFTAPITGSIT
LNHLGGGTTTLRGASTYAGATTVAGGTLRAGAANVFSANSAHTVAAAGTLDLDRFDQTLT
TLSSAGTVSLSGARLTLTGAYVGNGGTMILGVGPSGAPLVFAGPLASATGTTLLQITNLG
GLGSPTTGDGIAVISATGGATTTAQTTRDAFSLVGGQTGGGAYAYRLHAGDASGAGENWY
LRSTGYRSEASLYAVVPEQFRSLDIAMLGDRQQRLGEPRAARGTASGGERQAWGRLFNTD
RDIAQQGTVSPTSHGRIRGFQTGTDLWGDARWRTGVYLGKLQSEMAVNGFVSGEANYAAG
RNDLSSQYLGGYATWLPADGLYVDSVLQVGDHRYTAHASTGLASTGKGDSLVASVEVGRA
LALAPRWVLEPQLQIAYQRVSLDDNTISNASIEQDIDVGWIARLGARVKGQWDVGPGPLQ
LYGGLNVYKRSSGTDITRFVGTGGGTDIISRSGGTSGELTAGASWRVSARTSVYGELGKL
WDLGGDARTGSGVSGSVGVKLLW