Protein Info for PS417_27635 in Pseudomonas simiae WCS417

Annotation: magnesium chelatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 498 TIGR00368: Mg chelatase-like protein" amino acids 6 to 493 (488 residues), 649.2 bits, see alignment E=2e-199 PF05362: Lon_C" amino acids 19 to 164 (146 residues), 32.7 bits, see alignment E=2.1e-11 PF13541: ChlI" amino acids 21 to 142 (122 residues), 151.1 bits, see alignment E=4.6e-48 PF01078: Mg_chelatase" amino acids 190 to 391 (202 residues), 319.6 bits, see alignment E=2.6e-99 PF07728: AAA_5" amino acids 213 to 348 (136 residues), 36.4 bits, see alignment E=1.7e-12 PF00493: MCM" amino acids 287 to 387 (101 residues), 28.5 bits, see alignment E=2.8e-10 PF13335: Mg_chelatase_C" amino acids 402 to 493 (92 residues), 95.7 bits, see alignment E=7.1e-31

Best Hits

KEGG orthology group: K07391, magnesium chelatase family protein (inferred from 94% identity to pfs:PFLU5956)

Predicted SEED Role

"MG(2+) CHELATASE FAMILY PROTEIN / ComM-related protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UJK3 at UniProt or InterPro

Protein Sequence (498 amino acids)

>PS417_27635 magnesium chelatase (Pseudomonas simiae WCS417)
MSLAIVHSRAQIGVEAPAVTVEVHMANGLPSLTLVGLPETAVKESKDRVRSAILNSALQY
PARRITLNLAPADLPKDGGRFDLAIALGILAASVQVPASMLDEVECLGELALSGEVRAVK
GVLPAALAARKAGRTVIVPRANAEEACLASGLKVLAVDHLLQVVAHLNGHQPIEPYQSDG
LLYLNKPYPDLSEVQGQLAAKRALLIAAAGAHNLLLSGPPGTGKTLLASRLPGLLPPLSE
QEALEVAAIQSVVSVAPLSHWPHRPFRQPHHSASGPALVGGGSKPQPGEITLAHHGVLFL
DELPEFDRKVLEVLREPLESGHIVISRARDRVSFPARFQLVAAMNPCPCGYLGEPSGRCR
CTPEQIQRYRNKLSGPLLDRIDLHLTVARETTALNPTQQAGDNTAEASARVAQARDRQQQ
RQGCANAFLDLPGLRKHCKLAKVDECWLENACERLTLSLRAAHRLLKVARTLADLEHTDS
INRAHLAEALQYRPAAVG