Protein Info for GFF5395 in Variovorax sp. SCN45

Annotation: Glutamine ABC transporter, ATP-binding protein GlnQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 20 to 167 (148 residues), 124.9 bits, E=3.8e-40

Best Hits

Swiss-Prot: 56% identical to GLUA_CORGL: Glutamate transport ATP-binding protein GluA (gluA) from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025)

KEGG orthology group: None (inferred from 75% identity to hse:Hsero_0241)

MetaCyc: 51% identical to L-glutamine ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-12-RXN [EC: 7.4.2.1]

Predicted SEED Role

No annotation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.1

Protein Sequence (242 amino acids)

>GFF5395 Glutamine ABC transporter, ATP-binding protein GlnQ (Variovorax sp. SCN45)
MQPVVELNDVHKHFGKLHVLKGVSFSVQRGQVVAIIGQSGSGKSTALRCIDRLETIDSGT
IGCCGHAVHDPALNLRALRKDVGIVFQSYNLFPHLTVKQNITLAPQSVKKMSASEAGAIA
MEVLERVGLAEKADAYPEQLSGGQQQRVAIARSLAMKPQLMLFDEVTSALDPQLTGEVLK
VMEKLASEGMTMILVTHEMAFARGVADKVIYMHQGLVWEEGDASILSNPQTPELRQFIGT
GL