Protein Info for PS417_27600 in Pseudomonas simiae WCS417

Annotation: HAD family hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 231 PF00702: Hydrolase" amino acids 3 to 194 (192 residues), 88.4 bits, see alignment E=1.3e-28 PF13419: HAD_2" amino acids 6 to 199 (194 residues), 66.2 bits, see alignment E=5.7e-22 TIGR01549: HAD hydrolase, family IA, variant 1" amino acids 92 to 194 (103 residues), 50.4 bits, see alignment E=3.3e-17 TIGR01509: HAD hydrolase, family IA, variant 3" amino acids 97 to 199 (103 residues), 42.2 bits, see alignment E=9.2e-15 PF13242: Hydrolase_like" amino acids 155 to 222 (68 residues), 37.1 bits, see alignment E=3.7e-13

Best Hits

KEGG orthology group: K07025, putative hydrolase of the HAD superfamily (inferred from 90% identity to pfs:PFLU5949)

Predicted SEED Role

"Putative FMN hydrolase (EC 3.1.3.-); 5-Amino-6-(5'-phosphoribitylamino)uracil phosphatase" (EC 3.1.3.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.-

Use Curated BLAST to search for 3.1.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UH47 at UniProt or InterPro

Protein Sequence (231 amino acids)

>PS417_27600 HAD family hydrolase (Pseudomonas simiae WCS417)
MSIKLITFDLDDTLWDNVPVIISAEASMREWLTVNAAKVGDLPLEHFASLRQQVLERHPE
LKHRISLLRHRVLMHAFEEAGYPQPEATEMADVCFEAFIHARHQLAPFPEAEPMLKALRQ
HFLLGVITNGNADVQRVGLADYFHFALRAEDIGIAKPDARLFQEALQRGGVDASAAVHIG
DHPGDDIAGAQQAGLRAVWFNPTGKVWEADKRPDAEVRSLAELAPLLAGWK