Protein Info for GFF5390 in Variovorax sp. SCN45

Annotation: RecA protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 368 TIGR02012: protein RecA" amino acids 16 to 337 (322 residues), 571.7 bits, see alignment E=2.4e-176 PF00154: RecA" amino acids 19 to 281 (263 residues), 477 bits, see alignment E=4e-147 PF08423: Rad51" amino acids 49 to 239 (191 residues), 33.9 bits, see alignment E=5.3e-12 PF06745: ATPase" amino acids 52 to 226 (175 residues), 32.1 bits, see alignment E=1.9e-11 PF21096: RecA_C" amino acids 284 to 339 (56 residues), 96.1 bits, see alignment 2.6e-31

Best Hits

Swiss-Prot: 88% identical to RECA_DELAS: Protein RecA (recA) from Delftia acidovorans (strain DSM 14801 / SPH-1)

KEGG orthology group: K03553, recombination protein RecA (inferred from 98% identity to vpe:Varpa_5921)

MetaCyc: 68% identical to DNA recombination/repair protein RecA (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"RecA protein" in subsystem DNA-replication or DNA repair, bacterial or DNA repair, bacterial RecFOR pathway

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (368 amino acids)

>GFF5390 RecA protein (Variovorax sp. SCN45)
MDAVVKGASISVANSEKAKALQAALAQIEKQFGKGTIMRLGEGEALEDIQVVSTGSLGLD
IALGVGGLPRGRVIEIYGPESSGKTTLTLQVIAAMQKQAGTCAFVDAEHALDVQYAQKLG
VNLSDLLISQPDTGEQALEIVDSLVRSGAVDLIVVDSVAALTPKAEIEGEMGDSLPGLQA
RLMSQALRKLTATIKKTNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRI
GTIKKGDEAIGNETKVKVVKNKVSPPFKTAEFDILFGEGISREGEIIDMGVTAKIVDKSG
AWYAYNGEKIGQGRDNAREFLRENPELSREIENKVRESLGIPLLAADAGATPEKPQKAAK
AEKADKGE