Protein Info for PS417_27580 in Pseudomonas simiae WCS417

Annotation: diaminopimelate decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 415 TIGR01048: diaminopimelate decarboxylase" amino acids 7 to 410 (404 residues), 528.7 bits, see alignment E=3.9e-163 PF00278: Orn_DAP_Arg_deC" amino acids 31 to 368 (338 residues), 99.3 bits, see alignment E=1.8e-32 PF01168: Ala_racemase_N" amino acids 35 to 228 (194 residues), 27.8 bits, see alignment E=3.1e-10 PF02784: Orn_Arg_deC_N" amino acids 35 to 280 (246 residues), 257.8 bits, see alignment E=1.5e-80

Best Hits

Swiss-Prot: 91% identical to DCDA_PSEFL: Diaminopimelate decarboxylase (lysA) from Pseudomonas fluorescens

KEGG orthology group: K01586, diaminopimelate decarboxylase [EC: 4.1.1.20] (inferred from 98% identity to pfs:PFLU5945)

Predicted SEED Role

"Diaminopimelate decarboxylase (EC 4.1.1.20)" in subsystem Lysine Biosynthesis DAP Pathway (EC 4.1.1.20)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U368 at UniProt or InterPro

Protein Sequence (415 amino acids)

>PS417_27580 diaminopimelate decarboxylase (Pseudomonas simiae WCS417)
MDAFNYRDGELFAEGVALSAIAQRFGTPTYVYSRAHIEAQYRSFTDALDGVSHLVCYAVK
ANSNLGVLNVLARLGAGFDIVSRGELERVLAAGGKAEKIVFSGVGKTREDMRRALEVGVH
CFNIESTDELERLQVVAAEMGVRAPISLRVNPDVDAGTHPYISTGLKENKFGIAIADAED
VYIRAAQLPNLEVLGVDCHIGSQLTTLPPFLDALDRLLALIDRLGECGIYLHHIDLGGGV
GVRYRDEEPPLIADYIKAVRERIEGRDLTLMFEPGRYIVANAGVLLTQVEYLKHTEHKDF
AIVDAAMNDLIRPALYQAWMNVTAVTPRASEARAYDIVGPICETGDFLAKDRQLALEEGD
LLAIHSAGAYGFVMSSNYNTRGRTAEVLVDGDQAFEVRRRETVAELYAGESLLPE