Protein Info for GFF5387 in Variovorax sp. SCN45

Annotation: Two-component system histidine kinase BP2548

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 480 transmembrane" amino acids 18 to 38 (21 residues), see Phobius details amino acids 167 to 191 (25 residues), see Phobius details PF08521: 2CSK_N" amino acids 23 to 167 (145 residues), 116.7 bits, see alignment E=1.8e-37 PF26769: HAMP_PhoQ" amino acids 195 to 237 (43 residues), 39.5 bits, see alignment 9.1e-14 PF00512: HisKA" amino acids 245 to 309 (65 residues), 57.6 bits, see alignment E=2.1e-19 PF02518: HATPase_c" amino acids 359 to 475 (117 residues), 72.3 bits, see alignment E=9.1e-24

Best Hits

KEGG orthology group: K07649, two-component system, OmpR family, sensor histidine kinase TctE [EC: 2.7.13.3] (inferred from 93% identity to vpe:Varpa_5925)

Predicted SEED Role

"Sensor protein basS/pmrB (EC 2.7.3.-)" in subsystem Lipid A modifications or Orphan regulatory proteins (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3, 2.7.3.-

Use Curated BLAST to search for 2.7.13.3 or 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (480 amino acids)

>GFF5387 Two-component system histidine kinase BP2548 (Variovorax sp. SCN45)
VKLFQRAQRSLFGEILDWMLTPLLLLVPVSIGVTWLVAQGIANAPFDRALEHNVKALSEL
VTVKDGHTQFVLSQSAREILRADDAGHVYYQLLDGHGTLLSGERDIPQPGLDEPLPPNQV
FLHNSDVHGLPVRVASMWLASGSDDVPPSLLQLAETREKQSVLAAEIIKGVLLPQFAILP
LAVLLIWLALVRGIKPLSVVEARIRERRPGDLSPLDESSVPLEVVPLVSSVNELLDKLND
SIGTQKRFLADAAHQLKTPLAGLRMQADLAQREGANADELKQSLKQIGRASKRATHTVNQ
LLSLARAEGNSANVHHQPCDLARLTIEVVREAVPRAIEKRIDLGYDGAEAGAPGVMFDGN
QTLLKELVRNLVDNALNYTPSTPERPGLITVRVLADPFGHVLLLQVEDNGPGIAEADREL
VFEPFYRVLGNEADGSGLGLPIVREIANQHRALVKLEDAHPGKHPPGALFTVRFEAEAPV