Protein Info for GFF5382 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: domain of unknown function / Regulator of nucleoside diphosphate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 PF13523: Acetyltransf_8" amino acids 21 to 150 (130 residues), 31.1 bits, see alignment E=4.4e-11 PF13302: Acetyltransf_3" amino acids 22 to 148 (127 residues), 45.8 bits, see alignment E=2.6e-15 PF00583: Acetyltransf_1" amino acids 61 to 148 (88 residues), 30.3 bits, see alignment E=1.1e-10 PF14760: Rnk_N" amino acids 182 to 217 (36 residues), 34.9 bits, see alignment 4.4e-12 PF01272: GreA_GreB" amino acids 224 to 296 (73 residues), 56.2 bits, see alignment E=6.8e-19

Best Hits

KEGG orthology group: K06140, regulator of nucleoside diphosphate kinase (inferred from 82% identity to adn:Alide_2514)

Predicted SEED Role

"domain of unknown function / Regulator of nucleoside diphosphate kinase" in subsystem Transcription factors bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (306 amino acids)

>GFF5382 domain of unknown function / Regulator of nucleoside diphosphate kinase (Hydrogenophaga sp. GW460-11-11-14-LB1)
VVKMNKPFISLCPEITRANALTLMDWLEDECVTRHLSDSRHVSRFIEQVIGRVQLPILTH
LFNQGGRFFMAYDRHDVPVGFVRLVKTGRDCEMVLVIGNRDNWGRKLGASAISEAMKLAF
FDMRAEKLIAKIHADNERSLKAFQNCGFLLESQTPSLKSFSMTSESYLRRLRENPAGHRA
DIYITEIDKARLRSLVECEPPPAVFELEHEIERAIVVDPRRVARDVVTMNSRALLQLDDE
EVEVALVYPQDADGSDGKLSVCSSIGTAILGYKEGDTFDWRIPDRTCHIRIGKVLYQPEA
AGDFHL