Protein Info for GFF5374 in Variovorax sp. SCN45

Annotation: Glutamine amidotransferase, class I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 PF07722: Peptidase_C26" amino acids 29 to 257 (229 residues), 174.2 bits, see alignment E=3.4e-55 PF00117: GATase" amino acids 53 to 260 (208 residues), 59.6 bits, see alignment E=3.5e-20

Best Hits

KEGG orthology group: K07010, putative glutamine amidotransferase (inferred from 92% identity to vap:Vapar_5208)

Predicted SEED Role

"Para-aminobenzoate synthase, amidotransferase component (EC 2.6.1.85)" in subsystem Chorismate: Intermediate for synthesis of PAPA antibiotics, PABA, anthranilate, 3-hydroxyanthranilate and more. or Folate Biosynthesis or Tryptophan synthesis (EC 2.6.1.85)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.85

Use Curated BLAST to search for 2.6.1.85

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (314 amino acids)

>GFF5374 Glutamine amidotransferase, class I (Variovorax sp. SCN45)
MDFPFRITRPVRSVDSPAMTQPVSARLKIGLSACFSHADPARSLFTNKTLQYVEQSIAHW
LMSAGAMVVMVPCPTGETARGDTKLSHYAEWLDGVVMHGGADVWPGSYGEVPLKDAWIGD
RIRDLYDLALVEAFEQAGKPIFGVCRGLQLINVAFGGTLYQDIEAQHGHPETLKHRDPVT
YDQNFHQIELVQGTRLSKLYPDLKTARVNSIHHQGVKDIAPGFDIEAWSLPDRVPEAIRR
RPDRGRSYIAATQWHPEFHKYGSTETVDDTPILHDFLWACATARVAPRTSTMRGMPGRIR
NRAARLLRQALLRR