Protein Info for GFF5372 in Variovorax sp. SCN45

Annotation: Heme A synthase, cytochrome oxidase biogenesis protein Cox15-CtaA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 447 transmembrane" amino acids 7 to 33 (27 residues), see Phobius details amino acids 38 to 67 (30 residues), see Phobius details amino acids 77 to 105 (29 residues), see Phobius details amino acids 116 to 134 (19 residues), see Phobius details amino acids 140 to 170 (31 residues), see Phobius details amino acids 180 to 209 (30 residues), see Phobius details amino acids 220 to 250 (31 residues), see Phobius details amino acids 259 to 288 (30 residues), see Phobius details amino acids 301 to 331 (31 residues), see Phobius details amino acids 340 to 368 (29 residues), see Phobius details amino acids 380 to 410 (31 residues), see Phobius details amino acids 419 to 445 (27 residues), see Phobius details

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (447 amino acids)

>GFF5372 Heme A synthase, cytochrome oxidase biogenesis protein Cox15-CtaA (Variovorax sp. SCN45)
MSVAFSVLMVPLLAVRFVVLTFVAFSVLTVPLLADRFVVVMSVAFSVLMVPLLAVRLVVL
TLVAFNVLTVPLLADRLVVVMSVAFSVLMVPLLAVRLVVLTLVAFNVLTVPLLADRFVVV
MSVAFSVLTVPVVADRLDVVTLVAFSVLMVPLLAVRSVVLTLVAFSVLTVPVVADRLDVV
TLVAFSVLMVPLLAVRAVVLTLVAFSVLTVPVVADRLDVVTLVAFSVLMVPLLAVRSVVL
TLVAFSVLTVPVVADRLDVVTLVAFSVLMVPLPAVRSVVLTLVAFNVLTVPVVADRLDVV
TLVAFNVLMVPLLAVRAVVLTLVAFSVLTVPVVADRLDVVTLVAFSVLMVPLPAVRSVVL
TLVAFNVLTVPVVADRLDVVTLVAFSVLMVPLLAVKSVVLTLVAFSVLTVPVVADRLDVV
TVVAFNVLMVPLLAVRAVVLTLVAFSV