Protein Info for PS417_27465 in Pseudomonas simiae WCS417

Annotation: cystathionine gamma-synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 631 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details transmembrane" amino acids 375 to 400 (26 residues), see Phobius details amino acids 412 to 434 (23 residues), see Phobius details amino acids 443 to 463 (21 residues), see Phobius details amino acids 476 to 498 (23 residues), see Phobius details amino acids 520 to 542 (23 residues), see Phobius details amino acids 549 to 570 (22 residues), see Phobius details amino acids 601 to 619 (19 residues), see Phobius details PF13442: Cytochrome_CBB3" amino acids 132 to 215 (84 residues), 41.5 bits, see alignment E=2e-14 PF00034: Cytochrom_C" amino acids 135 to 216 (82 residues), 39.8 bits, see alignment E=1.4e-13 PF03239: FTR1" amino acids 379 to 579 (201 residues), 74.6 bits, see alignment E=1.3e-24

Best Hits

KEGG orthology group: K07243, high-affinity iron transporter (inferred from 98% identity to pfs:PFLU5918)

Predicted SEED Role

"Cytochrome c family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UMR5 at UniProt or InterPro

Protein Sequence (631 amino acids)

>PS417_27465 cystathionine gamma-synthase (Pseudomonas simiae WCS417)
MTAPFRFLVWLLLPALMSCSFNLLAATAEGAPQALHLLDYIGADYPPTVEAGKVIDESEY
REQLEFLGVLQGLVAELPQRPERAALVKGVDELLAAVTARQDGATVARQARQLGAQLAVA
YEVSQAPAITPDPTRGEPLYAQHCSVCHGTTGAGDGPASVGMTPPPANLRDPVRLDRLSL
YAVYNTLGLGVEGTDMPSFSDQLDDRQRWDLATYIAGFTADPAAAKSEQPFNLADLARQT
PNEVLAASGPAAAATFRAQRAQPPQVKRGPAQLLDYTATTLDKSLAAFRNGDHEQAYDLS
VAAYLEGFELVESSLDNVDANVRKDTEKALMAYRQSLQDGLPVEQVQQRLDVAKGKLTES
AGLLGSDGLSWSLSYISGLLILLREGLEAILVLAAILAFLRNTGQQSAVRSVNVGWGLAL
LAGLATWALAAYVIDVSGAQRELLEGCTALFASVMVLWLGVWMHDRRHAAAWQDYIKSSL
VGGGGRFGFAMLAFFSVYRELFEVILFYETLWLQAGPAGHNAVLAGGATALVLLVGLAWV
ILRGSAKLPLALFFGINAALLCALSVVFAGHGVKALQEAGIFGTRPVAFFDFDWLGIHAD
AYSLSAQAVAILAIVVLYGRSRVAEKRRVAA