Protein Info for GFF5364 in Variovorax sp. SCN45

Annotation: Twin-arginine translocation protein TatC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 270 transmembrane" amino acids 33 to 52 (20 residues), see Phobius details amino acids 79 to 104 (26 residues), see Phobius details amino acids 122 to 144 (23 residues), see Phobius details amino acids 173 to 194 (22 residues), see Phobius details amino acids 206 to 224 (19 residues), see Phobius details amino acids 230 to 251 (22 residues), see Phobius details TIGR00945: twin arginine-targeting protein translocase TatC" amino acids 23 to 241 (219 residues), 187 bits, see alignment E=2.3e-59 PF00902: TatC" amino acids 25 to 236 (212 residues), 198.3 bits, see alignment E=6.9e-63

Best Hits

KEGG orthology group: K03118, sec-independent protein translocase protein TatC (inferred from 92% identity to vpe:Varpa_1270)

Predicted SEED Role

"Twin-arginine translocation protein TatC" in subsystem Cluster-based Subsystem Grouping Hypotheticals - perhaps Proteosome Related or Twin-arginine translocation system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (270 amino acids)

>GFF5364 Twin-arginine translocation protein TatC (Variovorax sp. SCN45)
MADSDNKNKDKEDELAGTEQPFVAHLVELRDRLLYCVYGLVVAGILLAIWPGPGGLIDLI
AMPIKAHMPHDAKLIAIGVFSPFFVPLKVLMMAAVLLALPWLMYQAWMFVAPGLYSHEKK
FALPLIFFGSLLAYAGIAFVQLFVLDKMFSFIQRFAPAAVQATPDISSYVEAILSLYIAF
GVAFQVPIVVMLLVRFEMVTIEKLKSFRGYFIVVAFVVAAVLTPPDVVSQLALAVPMCLL
YEVGIIGAKYFASSGKKPEDEESADSASSS