Protein Info for GFF5359 in Variovorax sp. SCN45

Annotation: Phosphoribosyl-ATP pyrophosphatase (EC 3.6.1.31)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03188: phosphoribosyl-ATP diphosphatase
  • amino acids 13 to 103 (91 residues), 94.9 bits, E=1.4e-31
• PF01503: PRA-PH
  • amino acids 16 to 106 (91 residues), 57.5 bits, E=6.9e-20

Best Hits

Swiss-Prot: 88% identical to HIS2_VARPS: Phosphoribosyl-ATP pyrophosphatase (hisE) from Variovorax paradoxus (strain S110)

KEGG orthology group: K01523, phosphoribosyl-ATP pyrophosphohydrolase [EC: 3.6.1.31] (inferred from 90% identity to vpe:Varpa_1265)

Predicted SEED Role

"Phosphoribosyl-ATP pyrophosphatase (EC 3.6.1.31)" in subsystem Histidine Biosynthesis (EC 3.6.1.31)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (43/46 steps found)
• L-histidine biosynthesis (10/10 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Histidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.31

Protein Sequence (133 amino acids)

>GFF5359 Phosphoribosyl-ATP pyrophosphatase (EC 3.6.1.31) (Variovorax sp. SCN45)
MMAAVNTEISDALARLAAVIETRLPAQGGDPEKSYVARLLHKGPDAFLKKIGEEATEVVM
AAKDADHGGDRSKIVNEVADLWFHTMVALAHYGFSPADVVAELERREGTSGIEEKALRKV
QQRSSEEKGGVSG