Protein Info for GFF5356 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Protein crcB homolog

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 127 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 33 to 54 (22 residues), see Phobius details amino acids 66 to 89 (24 residues), see Phobius details amino acids 95 to 116 (22 residues), see Phobius details PF02537: CRCB" amino acids 6 to 117 (112 residues), 94.9 bits, see alignment E=1.8e-31 TIGR00494: protein CrcB" amino acids 6 to 117 (112 residues), 96.3 bits, see alignment E=7.6e-32

Best Hits

Swiss-Prot: 68% identical to CRCB_RHOFT: Putative fluoride ion transporter CrcB (crcB) from Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)

KEGG orthology group: K06199, CrcB protein (inferred from 68% identity to rfr:Rfer_1559)

MetaCyc: 48% identical to F- channel (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-498

Predicted SEED Role

"Protein crcB homolog"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (127 amino acids)

>GFF5356 Protein crcB homolog (Hydrogenophaga sp. GW460-11-11-14-LB1)
MHSVIAISLGAVLGALARWRLSLWLNQGAAVLPWGTLAANWIGAYIVGVAVVFFQSQTQI
DPVWRLAVITGFLGALTTFSTFSAEVIAMLQQGRFALAVGTAGLHLLGSLLLTWVGMRSA
AIWFTPA