Protein Info for GFF5354 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: TRAP dicarboxylate transporter, DctM subunit, unknown substrate 5

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 431 transmembrane" amino acids 6 to 35 (30 residues), see Phobius details amino acids 48 to 71 (24 residues), see Phobius details amino acids 103 to 123 (21 residues), see Phobius details amino acids 143 to 166 (24 residues), see Phobius details amino acids 176 to 200 (25 residues), see Phobius details amino acids 222 to 242 (21 residues), see Phobius details amino acids 248 to 269 (22 residues), see Phobius details amino acids 281 to 302 (22 residues), see Phobius details amino acids 320 to 378 (59 residues), see Phobius details amino acids 398 to 421 (24 residues), see Phobius details PF06808: DctM" amino acids 11 to 423 (413 residues), 278.2 bits, see alignment E=5.5e-87 TIGR00786: TRAP transporter, DctM subunit" amino acids 21 to 428 (408 residues), 387.9 bits, see alignment E=2.4e-120

Best Hits

KEGG orthology group: None (inferred from 78% identity to pol:Bpro_1772)

Predicted SEED Role

"TRAP dicarboxylate transporter, DctM subunit, unknown substrate 5"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (431 amino acids)

>GFF5354 TRAP dicarboxylate transporter, DctM subunit, unknown substrate 5 (Hydrogenophaga sp. GW460-11-11-14-LB1)
MNEVVVTTLLIVSLFALLGSGVWIGLTLAGVAWIGMELFSSRPAGDAMSITIWGSASSWT
LTALPLFVWMGEILFRTKLSESMFRGLAPWVNALPGRLLHTNILGSTIFAAVSGSSAATC
ATIGKMSIPELTKRGYPPEKIVGSLGGASTLGLLIPPSIIMIVYGVAAEVSIAKLFVAGV
LPGLMLAALFSGHLMIWALIHPDQVPRSDDRMSFRQKLGESRHLIPVILLIGGVIGTIYT
GIATATEAAAVGVVGSLILSAAQGSLNWGTFRDSLLGATRLYCMIALILAGAAFLTLSMG
YIGLPRHLAEFVTGLNLSPGVLLLALAVFYIVLGCFLDGISMIVLTMGVILPTVTAAGID
LIWFGIFVVIVVEMAQITPPVGFNLFVLQGMTKREITWIAKVCLPYFFIMVLAVLLLWWF
PQIVSWLPSRM