Protein Info for PS417_27400 in Pseudomonas simiae WCS417

Annotation: amino acid ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 19 to 166 (148 residues), 133.4 bits, E=1.8e-42
• PF13401: AAA_22
  • amino acids 28 to 194 (167 residues), 28.7 bits, E=2.9e-10

Best Hits

Swiss-Prot: 54% identical to GLUA_CORGL: Glutamate transport ATP-binding protein GluA (gluA) from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025)

KEGG orthology group: K02028, polar amino acid transport system ATP-binding protein [EC: 3.6.3.21] (inferred from 98% identity to pfs:PFLU5906)

MetaCyc: 51% identical to L-glutamine ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-12-RXN [EC: 7.4.2.1]

Predicted SEED Role

"Glutamate transport ATP-binding protein"

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.21

Use Curated BLAST to search for 3.6.3.21 or 7.4.2.1

Sequence Analysis Tools

See A0A1N7U5M3 at UniProt or InterPro

Protein Sequence (245 amino acids)

>PS417_27400 amino acid ABC transporter ATP-binding protein (Pseudomonas simiae WCS417)
MPLLRISALHKYYGDHHVLKGIDLTVEEGQVVAIIGRSGSGKSTLLRTLNGLESINDGVI
EVDGEYLDAARADLRSLRQKVGMVFQQFNLFPHLTVGENVMLAPQVVQKVPKAKAAQLAK
QMLERVGLGEKFDAFPDRLSGGQQQRVAIARALAMSPKVLLCDEITSALDPELVNEVLSV
VRQLAKDGMTLIMVTHEMRFAREVGDKLVFMHQGKVHEVGDPKVLFASPQTAELANFIGS
TEQSH