Protein Info for GFF535 in Sphingobium sp. HT1-2

Annotation: Succinyl-CoA:3-ketoacid-coenzyme A transferase subunit B (EC 2.8.3.5)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 215 TIGR02428: 3-oxoacid CoA-transferase, B subunit" amino acids 3 to 210 (208 residues), 324.3 bits, see alignment E=1.3e-101 PF01144: CoA_trans" amino acids 7 to 203 (197 residues), 153.6 bits, see alignment E=2.6e-49

Best Hits

Swiss-Prot: 70% identical to SCOB_XANCB: Succinyl-CoA:3-ketoacid coenzyme A transferase subunit B (lpsJ) from Xanthomonas campestris pv. campestris (strain B100)

KEGG orthology group: K01029, 3-oxoacid CoA-transferase subunit B [EC: 2.8.3.5] (inferred from 86% identity to nar:Saro_3824)

MetaCyc: 60% identical to succinyl-CoA-transferase subunit B (Helicobacter pylori 26695)
3-oxoacid CoA-transferase. [EC: 2.8.3.5]

Predicted SEED Role

"Succinyl-CoA:3-ketoacid-coenzyme A transferase subunit B (EC 2.8.3.5)" in subsystem Catechol branch of beta-ketoadipate pathway or Leucine Degradation and HMG-CoA Metabolism or Protocatechuate branch of beta-ketoadipate pathway or Serine-glyoxylate cycle (EC 2.8.3.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.8.3.5

Use Curated BLAST to search for 2.8.3.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (215 amino acids)

>GFF535 Succinyl-CoA:3-ketoacid-coenzyme A transferase subunit B (EC 2.8.3.5) (Sphingobium sp. HT1-2)
MSWTRDEMAARAAQELRDGYYVNLGIGIPTLVANHVPEGVNVTLQSENGMLGIGPFPFAG
EADPDLINAGKQTITALPTSSFFSSADSFAMIRGGHIDMAVLGAMEVAANGDLANWTIPG
KMVKGMGGAMDLVAGVKRVVVVMDHVSKNGSPKILDACTLPLTGKAVVDLIITDLAVIAV
DRAKGGLTLVELAPGVTEAEVIEKTGAPLAILENA