Protein Info for PS417_27340 in Pseudomonas simiae WCS417

Annotation: NADPH:quinone oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 PF08240: ADH_N" amino acids 28 to 87 (60 residues), 44.9 bits, see alignment E=1.4e-15 PF00107: ADH_zinc_N" amino acids 151 to 269 (119 residues), 109.4 bits, see alignment E=1.9e-35 PF13602: ADH_zinc_N_2" amino acids 184 to 322 (139 residues), 90.4 bits, see alignment E=3.1e-29

Best Hits

KEGG orthology group: K00344, NADPH2:quinone reductase [EC: 1.6.5.5] (inferred from 96% identity to pfs:PFLU5892)

MetaCyc: 37% identical to benzene hydroxylase alpha subunut (Geobacter metallireducens)
RXN-23213

Predicted SEED Role

"Quinone oxidoreductase (EC 1.6.5.5)" in subsystem ZZ gjo need homes (EC 1.6.5.5)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.5

Use Curated BLAST to search for 1.6.5.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UQF6 at UniProt or InterPro

Protein Sequence (325 amino acids)

>PS417_27340 NADPH:quinone oxidoreductase (Pseudomonas simiae WCS417)
MKAVLCKAFGPAETLVLEDVASPTIKKNEILLDVHAAGVNFPDTLIIEGKYQFKPPFPFS
PGGEAAGVVSEVGEKVSHLNVGDRVMALTGWGSFAEQVAVPSYNVLPIPPSMDFNTAAAF
SMTYGTSMHALKQRANLQPGETLLVLGASGGVGLAAVEIGKAMGARVIAAASSADKLEVA
NAAGADELINYSEASLKDEIKRLTDGNGADVIYDPVGGDLFDQAIRAIAWNGRLLVVGFA
SGRIPELPVNLALLKGAAVVGVFWGSFAQRQPQDNAANFQQLFTWYAEGKLKPLVSQVYP
LEQAAQAINDLGQRKAVGKVVVQTR