Protein Info for GFF534 in Variovorax sp. SCN45

Annotation: Two-component system sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 670 transmembrane" amino acids 26 to 47 (22 residues), see Phobius details amino acids 235 to 255 (21 residues), see Phobius details amino acids 262 to 280 (19 residues), see Phobius details amino acids 290 to 310 (21 residues), see Phobius details amino acids 321 to 340 (20 residues), see Phobius details amino acids 352 to 373 (22 residues), see Phobius details amino acids 381 to 399 (19 residues), see Phobius details amino acids 411 to 428 (18 residues), see Phobius details PF07695: 7TMR-DISM_7TM" amino acids 238 to 427 (190 residues), 30.4 bits, see alignment E=3.7e-11 PF02518: HATPase_c" amino acids 574 to 663 (90 residues), 45.6 bits, see alignment E=8.8e-16

Best Hits

KEGG orthology group: None (inferred from 72% identity to vap:Vapar_0380)

Predicted SEED Role

"probable two-component sensor histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (670 amino acids)

>GFF534 Two-component system sensor histidine kinase (Variovorax sp. SCN45)
MGYIRGAPVSGAPPERSALNSRPAPFFANVVLVLSMTLLAVIGAFFGGSSGLQKSNAALH
LKQADWQVEDTTGFSAPPLRQQAGDLPDAWQPIELPLAPPIALLRQADSDAAVGMSRAAR
PTRTTWLRVSTRHLPPSNGPLALYGARIKTDGTVAVYADGRLVHRAQQLGPLWNSTRTPL
WVELDRGPENTPPHEILIRLEHSRNAQIAVSSLWVGPIEALRGRHGLRQWLQQELPAMLS
AAFMAVGVFALFVWLRRRDEVGYLLFFNLSATSFMRGLHFYVGQPIANDWFAWLTVNSLF
WLVLVVHFFLRQLHQRRLKWLTWAVVLATSAVGVLTMPGLNLVQNTPRVTPLIYAVAALM
GTAVCLIGSISAWRRSTEGRLVAAGIGICVLLGITDWLLQNNFISPEGWYLGAYTNAVSF
SVFGVLMYRRYVHAIGAVEQLNDSLAERLRKREAELELSHQRLRDVERLRTISEERQRLM
QDMHDGLGSSLVSAIRSVEGGGMSDEKVSQILKSCLDDLKLTLDSLEPVDADLLLLLATL
RYRLAPRLEGTGVSLRWEVQELPALPWLDPSSALHILRIVQESISNILRHTRATEIRVET
ALVDSGVRVTIEDNGPGFDVDKVLASPSGRGMQNQRRRARSIGGAVSWESRPTGTRFMLW
LPLIREAEAA