Protein Info for GFF5339 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: 3-demethylubiquinone-9 3-methyltransferase (EC 2.1.1.64)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 235 TIGR01983: 3-demethylubiquinone-9 3-O-methyltransferase" amino acids 11 to 229 (219 residues), 279.2 bits, see alignment E=1e-87 PF06325: PrmA" amino acids 38 to 154 (117 residues), 33.7 bits, see alignment E=1.4e-11 PF08003: Methyltransf_9" amino acids 46 to 155 (110 residues), 27.5 bits, see alignment E=7.6e-10 PF01209: Ubie_methyltran" amino acids 47 to 156 (110 residues), 43 bits, see alignment E=1.7e-14 PF13489: Methyltransf_23" amino acids 49 to 205 (157 residues), 102.8 bits, see alignment E=8.6e-33 PF05175: MTS" amino acids 50 to 121 (72 residues), 27.3 bits, see alignment E=1.2e-09 PF02353: CMAS" amino acids 50 to 159 (110 residues), 38.7 bits, see alignment E=3.8e-13 PF13847: Methyltransf_31" amino acids 51 to 156 (106 residues), 69.9 bits, see alignment E=1.1e-22 PF13649: Methyltransf_25" amino acids 54 to 148 (95 residues), 73.7 bits, see alignment E=7.9e-24 PF08242: Methyltransf_12" amino acids 55 to 150 (96 residues), 68.5 bits, see alignment E=3.7e-22 PF08241: Methyltransf_11" amino acids 55 to 152 (98 residues), 82.1 bits, see alignment E=1.9e-26

Best Hits

Swiss-Prot: 77% identical to UBIG_RHOFT: Ubiquinone biosynthesis O-methyltransferase (ubiG) from Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)

KEGG orthology group: K00568, 3-demethylubiquinone-9 3-methyltransferase [EC: 2.1.1.- 2.1.1.64] (inferred from 76% identity to vap:Vapar_1622)

MetaCyc: 56% identical to bifunctional 3-demethylubiquinone-8 3-O-methyltransferase and 2-octaprenyl-6-hydroxyphenol methylase (Escherichia coli K-12 substr. MG1655)
3-demethylubiquinone-9 3-O-methyltransferase. [EC: 2.1.1.64]; 2-OCTAPRENYL-6-OHPHENOL-METHY-RXN [EC: 2.1.1.64, 2.1.1.222]

Predicted SEED Role

"3-demethylubiquinone-9 3-methyltransferase (EC 2.1.1.64)" in subsystem Ubiquinone Biosynthesis (EC 2.1.1.64)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-, 2.1.1.64

Use Curated BLAST to search for 2.1.1.- or 2.1.1.222 or 2.1.1.64

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (235 amino acids)

>GFF5339 3-demethylubiquinone-9 3-methyltransferase (EC 2.1.1.64) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MNPNVNADPAELAKFSDLAHRWWDPDSEFRPLHQINPLRLGWIDGLAGLAGKRVLDIGCG
GGILSDSMARKGANVTGIDLSVKALRVAQLHALEAGTANVNYQEISAEAMALEQPGEFDV
VTCMEMLEHVPDPASVVRACSTLVKPGGWVFFSTLNRNAKAFLFAVLGAEYLLQLLPKGT
HEYAKFIRPSELASYCRAAGLELDQTRGMEYNPFTQRYWLSSDTSVNYLFATRKP