Protein Info for PS417_27330 in Pseudomonas simiae WCS417

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 371 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details amino acids 174 to 198 (25 residues), see Phobius details amino acids 210 to 239 (30 residues), see Phobius details amino acids 253 to 279 (27 residues), see Phobius details amino acids 286 to 305 (20 residues), see Phobius details amino acids 343 to 365 (23 residues), see Phobius details PF12698: ABC2_membrane_3" amino acids 25 to 362 (338 residues), 142.2 bits, see alignment E=3.6e-45 PF12679: ABC2_membrane_2" amino acids 129 to 367 (239 residues), 48.4 bits, see alignment E=1.2e-16 PF01061: ABC2_membrane" amino acids 168 to 335 (168 residues), 97.3 bits, see alignment E=1.4e-31

Best Hits

Swiss-Prot: 51% identical to YHHJ_SHIFL: Inner membrane transport permease YhhJ (yhhJ) from Shigella flexneri

KEGG orthology group: K09686, antibiotic transport system permease protein (inferred from 96% identity to pfs:PFLU5890)

Predicted SEED Role

"ABC-type multidrug transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UJD7 at UniProt or InterPro

Protein Sequence (371 amino acids)

>PS417_27330 membrane protein (Pseudomonas simiae WCS417)
MHKFAHILRLGIKELTSLRHDGVLLLFLFYAFTVAIYMPAAGSVIGVHNASVAFVDEDHS
SLSRQMAEALQPPEFQAPIPLAYDQLDKVMDSGEYTFVINVPANFQADLLAGRQPGVQVN
VDATAMSQAFMGAGYIGRIFQRELLTYSGQAAANQAPALLTTRALFNTNLEGGWFLAVIQ
IVNNITILAIILTGTALLREREHGTLDHLLVLPLTALEIMLAKIWSNMLVVVLCTWLSLE
VVVKGLLGVPLAGSLGLFLFVTALYLFASTALGIFLATLARSTPQFGLLAIPVIIPMLLL
SGGSTPLDSMPEWLQWVMQGSPSTHFVSLSAAILFRDAGVSVVWPDVLALAGIGLLFFAV
ALARFRKSLAS