Protein Info for GFF533 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Putative preQ0 transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 246 transmembrane" amino acids 37 to 56 (20 residues), see Phobius details amino acids 62 to 85 (24 residues), see Phobius details amino acids 96 to 117 (22 residues), see Phobius details amino acids 125 to 147 (23 residues), see Phobius details amino acids 165 to 189 (25 residues), see Phobius details amino acids 209 to 231 (23 residues), see Phobius details TIGR00697: conserved hypothetical integral membrane protein" amino acids 37 to 230 (194 residues), 224.3 bits, see alignment E=6.8e-71 PF02592: Vut_1" amino acids 68 to 223 (156 residues), 127.5 bits, see alignment E=2.9e-41

Best Hits

Swiss-Prot: 90% identical to QPTR_ECOLI: Queuosine precursor transporter (yhhQ) from Escherichia coli (strain K12)

KEGG orthology group: K09125, hypothetical protein (inferred from 99% identity to sei:SPC_3648)

MetaCyc: 90% identical to queuosine precursor transporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-412

Predicted SEED Role

"Putative preQ0 transporter" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (246 amino acids)

>GFF533 Putative preQ0 transporter (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MPAQNSIMRRFFIGFPHPIQQKGHNMTPFTQSQRIKALFWLSLFHLLVIISSNYLVQLPI
TIFGFHTTWGAFSFPFIFLATDLTVRIFGAPLARRIIFAVMIPALLVSYVVSSLFYMGAW
QGFAALANFNLFVARIAAASFMAYALGQILDVHVFNRLRQNRRWWLAPTASTLFGNISDT
LAFFFIAFWRSPDAFMAGHWMEIALVDYCFKVLISIIFFLPMYGVLLNMLLKKLADKSEI
SPLPAS